Purified Membrane Proteins

Solute carrier family 25 member 53 (Mitochondrial carrier triple repeat protein 6)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S2553_HUMAN

Gene Name:

SLC25A53 MCART6

Uniprot Accession:

Q5H9E4

Origin:

Homo sapiens (Human)

Protein family:

Mitochondrial carrier (TC 2.A.29) family

Full-length:

307

AA

Mass:

34481

Da

MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAMAVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHSRKELKTD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes