Purified Membrane Proteins

Protein FAM209B

May play a role in sperm acrosome biogenesis. {ECO:0000250|UniProtKB:A2APA5}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

F209B_HUMAN

Gene Name:

FAM209B C20orf107

Uniprot Accession:

Q5JX69

Origin:

Homo sapiens (Human)

Protein family:

FAM209 family

Full-length:

171

AA

Mass:

19499

Da

MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVPCGEHFRIRQNLPEHTQGWLGSKWLWLLFAVVPFVILQCQRDSEKNKEQSPPGLRGFPFRTPLKKNQNASLYKDCVFNTLNELEVELLKFVSEVQNLKGAMATGSGSNLKLRRSEMPADPYHVTICKIWGEESSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes