Purified Membrane Proteins

Protein PAPPAS (DIPLA1 antisense RNA 1) (DIPLA1 antisense gene protein 1) (DIPLA1-antisense expressed) (PAPPAS antisense RNA 1) (PAPPAS antisense gene protein 1) (PAPPAS-antisense expressed)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PAPAS_HUMAN

Gene Name:

PAPPA-AS1 DIPAS PAPPAS

Uniprot Accession:

Q5QFB9

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

102

AA

Mass:

12196

Da

MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLSVIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes