Purified Membrane Proteins

Low-density lipoprotein receptor class A domain-containing protein 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LRAD2_HUMAN

Gene Name:

LDLRAD2

Uniprot Accession:

Q5SZI1

Origin:

Homo sapiens (Human)

Protein family:

LDLR family

Full-length:

272

AA

Mass:

28581

Da

MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLLLRSHAASRRFYFVAPDTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPPGAPRPLGSPLCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRCQNGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRSLTPSPALGSAGSLWIAAERSSPAGRDPTRQDAALEGSTE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes