Purified Membrane Proteins

Protein FAM162B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

F162B_HUMAN

Gene Name:

FAM162B C6orf189

Uniprot Accession:

Q5T6X4

Origin:

Homo sapiens (Human)

Protein family:

UPF0389 family

Full-length:

162

AA

Mass:

17685

Da

MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEIHRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes