Purified Membrane Proteins

Izumo sperm-egg fusion protein 3

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

IZUM3_HUMAN

Gene Name:

IZUMO3 C9orf134

Uniprot Accession:

Q5VZ72

Origin:

Homo sapiens (Human)

Protein family:

Izumo family

Full-length:

239

AA

Mass:

27768

Da

MGDLWLFLLLPLSAFHGVKGCLECDPKFIEDVGSLLGNLIPSEVPGRTQLLERQIKEMIHLSFKVSHSDKRLRVLAVQQVVKLRTWLKNEFYKLGNETWKGVFIYQGKLLDVCQNLESKLKELLKNFSEIACSEDCIVVEGPILDCWTCLRMTNRCFKGEYCGDEDPRKAENREIALFLILLATAVILGSAVLLFHFCIFHRRKMKAIRRSLKEYVEKKLEELMGKIDEKEEKDFRLRK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes