Purified Membrane Proteins

LysM and putative peptidoglycan-binding domain-containing protein 4

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LYSM4_HUMAN

Gene Name:

LYSMD4

Uniprot Accession:

Q5XG99

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

296

AA

Mass:

32066

Da

MRHEELLTKTFQGPAVVCGTPTSHVYMFKNGSGDSGDSSEEESHRVVLRPRGKERHKSGVHQPPQAGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes