Purified Membrane Proteins

Glycosyltransferase 8 domain-containing protein 1 (EC 2.4.1.-)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

GL8D1_HUMAN

Gene Name:

GLT8D1 GALA4A AD-017 MSTP137 UNQ572/PRO1134

Uniprot Accession:

Q68CQ7

Origin:

Homo sapiens (Human)

Protein family:

Glycosyltransferase 8 family

Full-length:

371

AA

Mass:

41935

Da

MSFRKVNIIILVLAVALFLLVLHHNFLSLSSLLRNEVTDSGIVGPQPIDFVPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTALKPGHAAAFSEDCDSASTKVVIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNITNQLEKWMKLNVEEGLYSRTLAGSITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWGRTASYTDVWEKWYIPDPTGKFNLIRRYTEISNIK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes