Purified Membrane Proteins

Transmembrane protein 225

Probably inhibits protein phosphatase 1 (PP1) in sperm via binding to catalytic subunit PPP1CC. {ECO:0000250|UniProtKB:Q9D9S2}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM225_HUMAN

Gene Name:

TMEM225 PMP22CD

Uniprot Accession:

Q6GV28

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

225

AA

Mass:

25828

Da

MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes