Purified Membrane Proteins

Aspartate beta-hydroxylase domain-containing protein 2 (EC 1.14.11.-)

May function as 2-oxoglutarate-dependent dioxygenase. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ASPH2_HUMAN

Gene Name:

ASPHD2

Uniprot Accession:

Q6ICH7

Origin:

Homo sapiens (Human)

Protein family:

Aspartyl/asparaginyl beta-hydroxylase family

Full-length:

369

AA

Mass:

41699

Da

MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes