Purified Membrane Proteins

Putative olfactory receptor 8G2 (Olfactory receptor 8G4) (Olfactory receptor OR11-292) (Olfactory receptor TPCR120)

Odorant receptor. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

O8G2P_HUMAN

Gene Name:

OR8G2P OR8G2 OR8G4

Uniprot Accession:

Q6IF36

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

304

AA

Mass:

33950

Da

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLFLLFLGIYVVTVVGNLSMITLIGLSSHLHTPMYYFLSGLSFIDLCHSTIITPKMLVNFVTEKNIISYPECMTQLYFFLIFAIAECHMLAVTAYDRYVAICSPLLYNVIMSYHHCFWLTVGVYVLGILGSTIHTGFMLRLFLCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILTPALTILASYIFIIASILRIRSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNPQSIA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes