Purified Membrane Proteins

CD164 sialomucin-like 2 protein

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

C16L2_HUMAN

Gene Name:

CD164L2 UNQ6122/PRO20044

Uniprot Accession:

Q6UWJ8

Origin:

Homo sapiens (Human)

Protein family:

CD164 family

Full-length:

174

AA

Mass:

18403

Da

MEAPGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVCEHCVEGDGARNLSSCVWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPKTVTTGSPPVPEAHSPGFDGASFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes