Purified Membrane Proteins

Protein shisa-like-2A

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SHL2A_HUMAN

Gene Name:

SHISAL2A FAM159A UNQ2783/PRO7171

Uniprot Accession:

Q6UWV7

Origin:

Homo sapiens (Human)

Protein family:

Shisa family

Full-length:

190

AA

Mass:

20306

Da

MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes