Purified Membrane Proteins

Transmembrane protein 14EP

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM14E_HUMAN

Gene Name:

TMEM14EP TMEM14E UNQ9344/PRO34067

Uniprot Accession:

Q6UXP3

Origin:

Homo sapiens (Human)

Protein family:

TMEM14 family

Full-length:

125

AA

Mass:

13608

Da

MQMDPGPQVPLYWLGFVYAALAALGGISGYAKVGSVQSPSAGFFFSELAGLDASQPSRNPKEHLSSPVYIWDLARYYANKILTLWNIYACGFSCRCLLIVSKLGSMYGEQILSVVAMSQLGLMKN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes