Purified Membrane Proteins

Izumo sperm-egg fusion protein 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

IZUM2_HUMAN

Gene Name:

IZUMO2 C19orf41 SCRL UNQ6978/PRO21961

Uniprot Accession:

Q6UXV1

Origin:

Homo sapiens (Human)

Protein family:

Izumo family

Full-length:

221

AA

Mass:

24856

Da

MPLALTLLLLSGLGAPGGWGCLQCDPLVLEALGHLRSALIPSRFQLEQLQARAGAVLMGMEGPFFRDYALNVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLRANVIKEFKKVLISYELKACNPKLCRLLKEEVLDCLHCQRITPKCIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVVSACTYRQNRKLLLQ

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes