Purified Membrane Proteins

Putative C-mannosyltransferase DPY19L2P2 (EC 2.4.1.-) (Dpy-19-like protein 2 pseudogene 2) (Protein dpy-19 homolog 2-like 2)

Probable C-mannosyltransferase that mediates C-mannosylation of tryptophan residues on target proteins. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

D19P2_HUMAN

Gene Name:

DPY19L2P2

Uniprot Accession:

Q6ZN68

Origin:

Homo sapiens (Human)

Protein family:

Dpy-19 family

Full-length:

376

AA

Mass:

43060

Da

MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLFFIYGTYLSGTELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSSSLLMTWAIILKRNEIQKLGVSKLNCWLIQGSAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDFDTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFKKTVGDISRVLATNVYLRCCLCRCHAYNGKCQAVYTSSHCESSTLRRCRLEAWLQHA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes