Purified Membrane Proteins

TLC domain-containing protein 5 (Transmembrane protein 136)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TLCD5_HUMAN

Gene Name:

TLCD5 TMEM136

Uniprot Accession:

Q6ZRR5

Origin:

Homo sapiens (Human)

Protein family:

TLCD5 family

Full-length:

245

AA

Mass:

27859

Da

MALALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSAYIGFIDGPWPFTHPGSPNTPLQVHVLCLTLGYFIFDLGWCVYFQSEGALMLAHHTLSILGIIMALVLGESGTEVNAVLFGSELTNPLLQMRWFLRETGHYHSFTGDVVDFLFVALFTGVRIGVGACLLFCEMVSPTPKWFVKAGGVAMYAVSWCFMFSIWRFAWRKSIKKYHAWRSRRSEERQLKHNGHLKIH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes