Purified Membrane Proteins

Putative microRNA 17 host gene protein (Putative microRNA host gene 1 protein)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

MIRH1_HUMAN

Gene Name:

MIR17HG C13orf25 MIRH1 MIRHG1

Uniprot Accession:

Q75NE6

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

70

AA

Mass:

8163

Da

MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSASWMVGYDCLL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes