Purified Membrane Proteins

Small integral membrane protein 29 (Protein LBH)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM29_HUMAN

Gene Name:

SMIM29 C6orf1 LBH

Uniprot Accession:

Q86T20

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

102

AA

Mass:

11550

Da

MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSYDPAEELHEAEQELLSDMGDPKVVHGWQSGYQHKRMPLLDVKT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes