Purified Membrane Proteins

Catechol O-methyltransferase domain-containing protein 1 (EC 2.1.1.-)

Putative O-methyltransferase. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CMTD1_HUMAN

Gene Name:

COMTD1 UNQ766/PRO1558

Uniprot Accession:

Q86VU5

Origin:

Homo sapiens (Human)

Protein family:

Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family

Full-length:

262

AA

Mass:

28809

Da

MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes