Purified Membrane Proteins

Trem-like transcript 1 protein

Cell surface receptor that may play a role in the innate and adaptive immune response.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TRML1_HUMAN

Gene Name:

TREML1

Uniprot Accession:

Q86YW5

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

311

AA

Mass:

32679

Da

MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes