Purified Membrane Proteins

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4) (Protein FAM77A)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NKAI4_HUMAN

Gene Name:

NKAIN4 C20orf58 FAM77A

Uniprot Accession:

Q8IVV8

Origin:

Homo sapiens (Human)

Protein family:

NKAIN family

Full-length:

208

AA

Mass:

23240

Da

MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes