Purified Membrane Proteins

Type III endosome membrane protein TEMP (TEMP)

May be involved in membrane trafficking between endosomes and plasma membrane.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CA210_HUMAN

Gene Name:

C1orf210

Uniprot Accession:

Q8IVY1

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

113

AA

Mass:

12024

Da

MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes