Purified Membrane Proteins

Protein shisa-5 (Putative NF-kappa-B-activating protein 120) (Scotin)

Can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis. {ECO:0000269|PubMed:12135983}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SHSA5_HUMAN

Gene Name:

SHISA5 SCOTIN PSEC0133

Uniprot Accession:

Q8N114

Origin:

Homo sapiens (Human)

Protein family:

Shisa family

Full-length:

240

AA

Mass:

25582

Da

MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes