Purified Membrane Proteins

Porimin (Keratinocytes-associated transmembrane protein 3) (KCT-3) (Pro-oncosis receptor inducing membrane injury) (Transmembrane protein 123)

Implicated in oncotic cell death, characterized by cell swelling, organelle swelling, vacuolization and increased membrane permeability. {ECO:0000269|PubMed:11481458}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PORIM_HUMAN

Gene Name:

TMEM123 KCT3 PSEC0111 UNQ641/PRO1271

Uniprot Accession:

Q8N131

Origin:

Homo sapiens (Human)

Protein family:

CD164 family

Full-length:

208

AA

Mass:

21531

Da

MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes