Purified Membrane Proteins

ORM1-like protein 3

Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling. {ECO:0000269|PubMed:20182505}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ORML3_HUMAN

Gene Name:

ORMDL3

Uniprot Accession:

Q8N138

Origin:

Homo sapiens (Human)

Protein family:

ORM family

Full-length:

153

AA

Mass:

17495

Da

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes