Purified Membrane Proteins

Gap junction delta-3 protein (Connexin-31.9) (Cx31.9) (Gap junction alpha-11 protein) (Gap junction chi-1 protein)

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CXD3_HUMAN

Gene Name:

GJD3 GJA11 GJC1

Uniprot Accession:

Q8N144

Origin:

Homo sapiens (Human)

Protein family:

Connexin family, Delta-type subfamily

Full-length:

294

AA

Mass:

31933

Da

MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes