Purified Membrane Proteins

Protein SYS1 homolog

Involved in protein trafficking. May serve as a receptor for ARFRP1.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SYS1_HUMAN

Gene Name:

SYS1 C20orf169

Uniprot Accession:

Q8N2H4

Origin:

Homo sapiens (Human)

Protein family:

SYS1 family

Full-length:

156

AA

Mass:

17615

Da

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes