Purified Membrane Proteins

Lysoplasmalogenase-like protein TMEM86A (Transmembrane protein 86A)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM86A_HUMAN

Gene Name:

TMEM86A

Uniprot Accession:

Q8N2M4

Origin:

Homo sapiens (Human)

Protein family:

TMEM86 family

Full-length:

240

AA

Mass:

26398

Da

MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAGSGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes