Purified Membrane Proteins

Solute carrier family 25 member 45

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S2545_HUMAN

Gene Name:

SLC25A45

Uniprot Accession:

Q8N413

Origin:

Homo sapiens (Human)

Protein family:

Mitochondrial carrier (TC 2.A.29) family

Full-length:

288

AA

Mass:

31906

Da

MPVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLRWWG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes