Purified Membrane Proteins

Ceramide synthase 5 (CerS5) (LAG1 longevity assurance homolog 5) (Sphingoid base N-palmitoyltransferase CERS5) (EC 2.3.1.291) (Sphingosine N-acyltransferase CERS5) (EC 2.3.1.24)

Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA)(PubMed:16951403, PubMed:18541923, PubMed:22144673, PubMed:22661289, PubMed:23530041, PubMed:26887952, PubMed:29632068, PubMed:31916624). Can use other acyl donors, but with less efficiency (By similarity). N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively (PubMed:31916624). Plays a role in de novo ceramide synthesis and surfactant homeostasis in pulmonary epithelia (By similarity). {ECO:0000250|UniProtKB:Q9D6K9, ECO:0000269|PubMed:16951403, ECO:0000269|PubMed:18541923, ECO:0000269|PubMed:22144673, ECO:0000269|PubMed:22661289, ECO:0000269|PubMed:23530041, ECO:0000269|PubMed:26887952, ECO:0000269|PubMed:29632068, ECO:0000269|PubMed:31916624}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CERS5_HUMAN

Gene Name:

CERS5 LASS5

Uniprot Accession:

Q8N5B7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

392

AA

Mass:

45752

Da

MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes