Purified Membrane Proteins

Membrane-spanning 4-domains subfamily A member 15

May be involved in signal transduction as a component of a multimeric receptor complex. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

M4A15_HUMAN

Gene Name:

MS4A15

Uniprot Accession:

Q8N5U1

Origin:

Homo sapiens (Human)

Protein family:

MS4A family

Full-length:

240

AA

Mass:

25050

Da

MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGEPKVLGTVQILIGLIHLGFGSVLLMVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes