Purified Membrane Proteins

Lysoplasmalogenase (EC 3.3.2.2) (Transmembrane protein 86B)

Enzyme catalyzing the degradation of lysoplasmalogen. Lysoplasmalogens are formed by the hydrolysis of the abundant membrane glycerophospholipids plasmalogens. May control the respective levels of plasmalogens and lysoplasmalogens in cells and modulate cell membrane properties. {ECO:0000269|PubMed:21515882}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM86B_HUMAN

Gene Name:

TMEM86B

Uniprot Accession:

Q8N661

Origin:

Homo sapiens (Human)

Protein family:

TMEM86 family

Full-length:

226

AA

Mass:

24352

Da

MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPLQPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFTLSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes