Purified Membrane Proteins

E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)

E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway (PubMed:18298843). Also plays a role in the inhibition of TLR-triggered innate immune response by mediating ‘Lys’-48-linked ubiquitination and subsequent degradation of NF-kappa-B component RELA (PubMed:31432514). {ECO:0000269|PubMed:18298843, ECO:0000269|PubMed:31432514}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

RN182_HUMAN

Gene Name:

RNF182

Uniprot Accession:

Q8N6D2

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

247

AA

Mass:

27402

Da

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes