Purified Membrane Proteins

Keratinocyte-associated protein 2 (KCP-2) (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2) (Oligosaccharyl transferase subunit KCP2)

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity (PubMed:22467853). May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1 (PubMed:21768116). {ECO:0000269|PubMed:21768116, ECO:0000269|PubMed:22467853}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KTAP2_HUMAN

Gene Name:

KRTCAP2 KCP2

Uniprot Accession:

Q8N6L1

Origin:

Homo sapiens (Human)

Protein family:

KRTCAP2 family

Full-length:

136

AA

Mass:

14679

Da

MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes