Purified Membrane Proteins

Acyl-coenzyme A diphosphatase FITM2 (EC 3.6.1.-) (Fat storage-inducing transmembrane protein 2) (Fat-inducing protein 2)

Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4′-phosphopantetheine and adenosine 3′,5′-bisphosphate (PubMed:32915949) (By similarity). Preferentially hydrolyzes unsaturated long-chain acyl-CoA substrates such as oleoyl-CoA/(9Z)-octadecenoyl-CoA and arachidonoyl-CoA/(5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA in the endoplasmic reticulum (ER) lumen (PubMed:32915949) (By similarity). This catalytic activity is required for maintaining ER structure and for lipid droplets (LDs) biogenesis, which are lipid storage organelles involved in maintaining lipid and energy homeostasis (PubMed:18160536, PubMed:32915949) (By similarity). Directly binds to diacylglycerol (DAGs) and triacylglycerol, which is also important for LD biogenesis (By similarity). May support directional budding of nacent LDs from the ER into the cytosol by reducing DAG levels at sites of LD formation (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization (PubMed:21834987) (By similarity). {ECO:0000255|HAMAP-Rule:MF_03230, ECO:0000269|PubMed:18160536, ECO:0000269|PubMed:21834987, ECO:0000269|PubMed:32915949}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

FITM2_HUMAN

Gene Name:

FITM2 C20orf142 FIT2

Uniprot Accession:

Q8N6M3

Origin:

Homo sapiens (Human)

Protein family:

FIT family, FIT2 subfamily

Full-length:

262

AA

Mass:

29855

Da

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes