Purified Membrane Proteins

Leucine-rich single-pass membrane protein 1

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LSME1_HUMAN

Gene Name:

LSMEM1 C7orf53

Uniprot Accession:

Q8N8F7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

131

AA

Mass:

14462

Da

MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes