Purified Membrane Proteins

E3 ubiquitin-protein ligase RNF152 (EC 2.3.2.27) (RING finger protein 152) (RING-type E3 ubiquitin transferase RNF152)

E3 ubiquitin-protein ligase mediating ‘Lys-63’-linked polyubiquitination of RRAGA in response to amino acid starvation. Thereby, regulates mTORC1 signaling and plays a role in the cellular response to amino acid availability (PubMed:25936802). Also mediates ‘Lys-48’-linked polyubiquitination of target proteins and their subsequent targeting to the proteasome for degradation. Induces apoptosis when overexpressed (PubMed:21203937). {ECO:0000269|PubMed:21203937, ECO:0000269|PubMed:25936802}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

RN152_HUMAN

Gene Name:

RNF152

Uniprot Accession:

Q8N8N0

Origin:

Homo sapiens (Human)

Protein family:

RNF152 family

Full-length:

203

AA

Mass:

22357

Da

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes