Purified Membrane Proteins

Nutritionally-regulated adipose and cardiac enriched protein homolog

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NRAC_HUMAN

Gene Name:

NRAC C14orf180 C14orf77

Uniprot Accession:

Q8N912

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

160

AA

Mass:

18051

Da

MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCGRAKPVATALEDLRARLLGLVLHLRHVALTCWRGLLRL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes