Purified Membrane Proteins

Nuclear envelope phosphatase-regulatory subunit 1 (NEP1-R1) (Transmembrane protein 188)

Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. {ECO:0000269|PubMed:22134922}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NEPR1_HUMAN

Gene Name:

CNEP1R1 C16orf69 TMEM188

Uniprot Accession:

Q8N9A8

Origin:

Homo sapiens (Human)

Protein family:

CNEP1R1 family

Full-length:

125

AA

Mass:

14267

Da

MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes