Purified Membrane Proteins

Putative protein encoded by LINC02912

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TMM75_HUMAN

Gene Name:

LINC02912 TMEM75

Uniprot Accession:

Q8N9X5

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

138

AA

Mass:

15361

Da

MRPTADSFRLKKGNVFPNFDPCAQALQKSCHFALSFLIGKMGIIILSVCLICTRLLQEGIAQSKCLINVSFSLYSCFIVFVTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVSKQLRNRAG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes