Purified Membrane Proteins

Fibronectin type III domain-containing protein 5 (Fibronectin type III repeat-containing protein 2) [Cleaved into: Irisin]

[Irisin]: Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue. {ECO:0000269|PubMed:24040023}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

FNDC5_HUMAN

Gene Name:

FNDC5 FRCP2

Uniprot Accession:

Q8NAU1

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

212

AA

Mass:

23659

Da

MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes