Purified Membrane Proteins

Transmembrane protein 229B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T229B_HUMAN

Gene Name:

TMEM229B C14orf83

Uniprot Accession:

Q8NBD8

Origin:

Homo sapiens (Human)

Protein family:

TMEM229 family

Full-length:

167

AA

Mass:

19531

Da

MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIVERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPSGALALANGHVKTD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes