Purified Membrane Proteins

Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3 (EC 7.2.1.3) (Cytochrome b ascorbate-dependent protein 3) (Cytochrome b561 family member A3) (Lysosomal cytochrome b) (LCytb)

Transmembrane reductase that uses ascorbate as an electron donor in the cytoplasm and transfers electrons across membranes to reduce iron cations Fe(3+) into Fe(2+) in the lumen of the late endosome and lysosome. Reduced iron can then be extruded from the late endosome and lysosome to the cytoplasm by divalent metal-specific transporters. It is therefore most probably involved in endosomal and lysosomal cellular iron homeostasis. {ECO:0000250|UniProtKB:Q6P1H1}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CYAC3_HUMAN

Gene Name:

CYB561A3 CYBASC3 PSEC0259

Uniprot Accession:

Q8NBI2

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

242

AA

Mass:

27214

Da

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQSWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFLLPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAFGLLVLYILLASSWKRPEPGILTDRQPLLHDGE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes