Purified Membrane Proteins

Golgi membrane protein 1 (Golgi membrane protein GP73) (Golgi phosphoprotein 2)

Unknown. Cellular response protein to viral infection.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

GOLM1_HUMAN

Gene Name:

GOLM1 C9orf155 GOLPH2 PSEC0242 UNQ686/PRO1326

Uniprot Accession:

Q8NBJ4

Origin:

Homo sapiens (Human)

Protein family:

GOLM family

Full-length:

401

AA

Mass:

45333

Da

MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes