Purified Membrane Proteins

Transmembrane protein 178A

Acts as a negative regulator of osteoclast differentiation in basal and inflammatory conditions by regulating TNFSF11-induced Ca (2+) fluxes, thereby controlling the induction of NFATC1. {ECO:0000250|UniProtKB:Q9CZ16}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T178A_HUMAN

Gene Name:

TMEM178A TMEM178 PSEC0131 UNQ5926/PRO19820

Uniprot Accession:

Q8NBL3

Origin:

Homo sapiens (Human)

Protein family:

TMEM178 family

Full-length:

297

AA

Mass:

33019

Da

MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes