Purified Membrane Proteins

Outer mitochondrial transmembrane helix translocase (EC 7.4.2.-) (ATPase family AAA domain-containing protein 1) (hATAD1) (Thorase)

Outer mitochondrial translocase required to remove mislocalized tail-anchored transmembrane proteins on mitochondria (PubMed:24843043). Specifically recognizes and binds tail-anchored transmembrane proteins: acts as a dislocase that mediates the ATP-dependent extraction of mistargeted tail-anchored transmembrane proteins from the mitochondrion outer membrane (By similarity). Also plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory (By similarity). Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent (By similarity). {ECO:0000250|UniProtKB:P28737, ECO:0000250|UniProtKB:Q9D5T0, ECO:0000269|PubMed:24843043}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ATAD1_HUMAN

Gene Name:

ATAD1 FNP001

Uniprot Accession:

Q8NBU5

Origin:

Homo sapiens (Human)

Protein family:

AAA ATPase family, MSP1 subfamily

Full-length:

361

AA

Mass:

40744

Da

MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMKQIGVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes