Purified Membrane Proteins

UDP-glucuronic acid decarboxylase 1 (EC 4.1.1.35) (UDP-glucuronate decarboxylase 1) (UGD) (UXS-1) (hUXS) (hUXS1)

Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose (PubMed:23656592, PubMed:22810237, PubMed:25521717). Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis (PubMed:23656592, PubMed:22810237, PubMed:25521717). {ECO:0000269|PubMed:22810237, ECO:0000269|PubMed:23656592, ECO:0000269|PubMed:25521717}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

UXS1_HUMAN

Gene Name:

UXS1 UNQ2538/PRO6079

Uniprot Accession:

Q8NBZ7

Origin:

Homo sapiens (Human)

Protein family:

NAD(P)-dependent epimerase/dehydratase family, UDP-glucuronic acid decarboxylase subfamily

Full-length:

420

AA

Mass:

47577

Da

MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes