Purified Membrane Proteins

C-type lectin domain family 1 member A (C-type lectin-like receptor 1) (CLEC-1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CLC1A_HUMAN

Gene Name:

CLEC1A CLEC1 UNQ569/PRO1131

Uniprot Accession:

Q8NC01

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

280

AA

Mass:

31952

Da

MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes