Purified Membrane Proteins

Mitoregulin (Micropeptide in mitochondria) (Micropeptide regulator of beta-oxidation) (Small integral membrane protein 37) (lncRNA-encoded micropeptide)

Positively regulates mitochondrial complex assembly and/or stability (By similarity). Increases mitochondrial membrane potential while decreasing mitochondrial reactive oxygen species (PubMed:29949756). Increases mitochondrial respiration rate (PubMed:29949756). Increased mitochondrial respiratory activity promotes myogenic differentiation which facilitates muscle growth and regeneration (By similarity). Increases mitochondrial calcium retention capacity (PubMed:29949756). Plays a role in maintenance of cellular lipid composition through its interaction with cytochrome b5 reductase CYB5R3 which is required for mitochondrial respiratory complex I activity (By similarity). Interacts with the mitochondrial trifunctional enzyme complex (MTE) and enhances fatty acid beta-oxidation (PubMed:32243843). Not required for MTE formation or stability (By similarity). Modulates triglyceride clearance in adipocytes through its role in regulating fatty acid beta-oxidation and lipolysis (PubMed:32243843). {ECO:0000250|UniProtKB:Q8BT35, ECO:0000269|PubMed:29949756, ECO:0000269|PubMed:32243843}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

MTLN_HUMAN

Gene Name:

MTLN LEMP LINC00116 MOXI MPM NCRNA00116 SMIM37

Uniprot Accession:

Q8NCU8

Origin:

Homo sapiens (Human)

Protein family:

Mitoregulin family

Full-length:

56

AA

Mass:

6527

Da

MADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes